Structure of PDB 2vvq Chain C

Receptor sequence
>2vvqC (length=158) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
GMRVYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIA
AATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREH
NNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYERTH
EAPPVPGA
3D structure
PDB2vvq D-Ribose-5-Phosphate Isomerase B from Escherichia Coli is Also a Functional D-Allose-6-Phosphate Isomerase, While the Mycobacterium Tuberculosis Enzyme is not.
ChainC
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D11 G69 S71 H102 H138
Catalytic site (residue number reindexed from 1) D9 G67 S69 H100 H136
Enzyme Commision number 5.3.1.6: ribose-5-phosphate isomerase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 R10 C D11 H12 Y46 G70 S71 G72 G74 E75 R113 D9 H10 Y44 G68 S69 G70 G72 E73 R111
BS02 R10 C H102 R137 R141 H100 R135 R139
Gene Ontology
Molecular Function
GO:0004751 ribose-5-phosphate isomerase activity
GO:0005515 protein binding
GO:0016853 isomerase activity
GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0006098 pentose-phosphate shunt
GO:0009052 pentose-phosphate shunt, non-oxidative branch
GO:0019316 D-allose catabolic process
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2vvq, PDBe:2vvq, PDBj:2vvq
PDBsum2vvq
PubMed18640127
UniProtP9WKD7|RPIB_MYCTU Ribose-5-phosphate isomerase B (Gene Name=rpiB)

[Back to BioLiP]