Structure of PDB 2vpe Chain C

Receptor sequence

>2vpeC (length=62) Species: 9606 (Homo sapiens) [Search protein sequence]

GAMAVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAE
ASAVWGCDTCMA

3D structure

PDB

2vpe Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.

Chain

Resolution

1.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	C	G373 M374 T375 T377 A378 L382 S387 A388 V389 W390 M396	G38 M39 T40 T42 A43 L47 S52 A53 V54 W55 M61
BS02	peptide	C	Y341 D352 Q354 A356 I357 L358 E360 W366 Y379 L382 T383 A388	Y6 D17 Q19 A21 I22 L23 E25 W31 Y44 L47 T48 A53
BS03	ZN	C	C343 C346 H368 C371	C8 C11 H33 C36
BS04	ZN	C	C359 C363 C392 C395	C24 C28 C57 C60

External links

PDB	RCSB:2vpe, PDBe:2vpe, PDBj:2vpe
PDBsum	2vpe
PubMed	18498752
UniProt	Q9Y3Y4\|PYGO1_HUMAN Pygopus homolog 1 (Gene Name=PYGO1)