Structure of PDB 2v1s Chain C

Receptor sequence
>2v1sC (length=69) Species: 10116 (Rattus norvegicus) [Search protein sequence]
SDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLL
QVLQQTLPPPVFQMLLTKL
3D structure
PDB2v1s Tom20 Recognizes Mitochondrial Presequences Through Dynamic Equilibrium Among Multiple Bound States.
ChainC
Resolution2.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C V66 Q67 K68 F70 L71 V99 C100 Q102 P103 Q105 L106 V9 Q10 K11 F13 L14 V42 C43 Q45 P46 Q48 L49
BS02 peptide C L71 E78 L110 T113 L14 E21 L53 T56
Gene Ontology
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2v1s, PDBe:2v1s, PDBj:2v1s
PDBsum2v1s
PubMed17948058
UniProtQ62760|TOM20_RAT Mitochondrial import receptor subunit TOM20 homolog (Gene Name=Tomm20)

[Back to BioLiP]