Structure of PDB 2ri4 Chain C

Receptor sequence

>2ri4C (length=138) Species: 9925 (Capra hircus)

LSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHG
SAQVKGHGEKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLL
SHSLLVTLACHLPNDFTPAVHASLDKFLANVSTVLTSK

3D structure

• PDB: 2ri4 Crystallization of sheep (Ovis aries) and goat (Capra hircus) haemoglobins under unbuffered low-salt conditions
• Chain: C
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	M32 F43 H58 K61 V62 L86 H87 L91 N97 F98 L101 L136	M31 F42 H57 K60 V61 L85 H86 L90 N96 F97 L100 L135

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:2ri4, PDBe:2ri4, PDBj:2ri4
• PDBsum: 2ri4
• UniProt: P0CH25|HBA1_CAPHI Hemoglobin subunit alpha-1 (Gene Name=HBA1)