Structure of PDB 2r4h Chain C |
>2r4hC (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] |
TENLYFQSMDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAER SGKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLFLKRGETSV |
|
PDB | 2r4h Crystal structure of a C1190S mutant of the 6th PDZ domain of human membrane associated guanylate kinase. |
Chain | C |
Resolution | 2.05 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
K13 |
Catalytic site (residue number reindexed from 1) |
K21 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HIS |
C |
M27 D28 |
M35 D36 |
|
|
|