Structure of PDB 2ql7 Chain C |
>2ql7C (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] |
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGF DVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGV TPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ |
|
PDB | 2ql7 Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis. |
Chain | C |
Resolution | 2.4 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
C |
R387 H444 C486 |
R31 H88 C130 |
|
|
|
|