Structure of PDB 2pms Chain C |
>2pmsC (length=109) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] |
GSHMDAEEVAPQAKIAELENQVHRLEQELKEIDEAPLQSKLDAKKAKLSK LEELSDKIDELDAEIAKLEDQLKAAEEEDYFKEGLEKTIAAKKAELEKTE ADLKKAVNE |
|
PDB | 2pms Structure of a Complex of Human Lactoferrin N-lobe with Pneumococcal Surface Protein A Provides Insight into Microbial Defense Mechanism. |
Chain | C |
Resolution | 2.91 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
H166 D168 |
H3 D5 |
|
|
|