Structure of PDB 2pa4 Chain C

Receptor sequence

>2pa4C (length=299) Species: 196627 (Corynebacterium glutamicum ATCC 13032)

NAVKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGAT
RLAIITAPNKAGVLAHFERSSELEETLMERGKTDQVEIIRRAADLIKAVP
VTQDKPLGLGHAVGLAESVLDDDEDVVAVMLPDDLVLPTGVMERMAQVRA
EFGGSVLCAVEVSEADVSKYGIFEIEADTKDSDVKKVKGMVEKPAIEDAP
SRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDEGHPVHIVI
HQGKRHDLGNPGGYIPACVDFGLSHPVYGAQLKDAIKQILAEHEAAERI

3D structure

• PDB: 2pa4 Active site geometry of glucose-1-phosphate uridylyltransferase.
• Chain: C
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UPG	C	P18 A20 G21 E36 Q112 P115 G117 L118 L140 P141 D143 Y179 G180 E201 K202 A214	P9 A11 G12 E27 Q103 P106 G108 L109 L131 P132 D134 Y170 G171 E192 K193 A205

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 17:56:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '2pa4', asym_id = 'C', title = 'Active site geometry of glucose-1-phosphate uridylyltransferase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='2pa4', asym_id='C', title='Active site geometry of glucose-1-phosphate uridylyltransferase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003983,0006011,0009058', uniprot = '', pdbid = '2pa4', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003983,0006011,0009058', uniprot='', pdbid='2pa4', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>