Structure of PDB 2p6f Chain C

Receptor sequence

>2p6fC (length=436) Species: 4932 (Saccharomyces cerevisiae)

DKAKKLENLLKLLQLNNDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDIS
DKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEF
FNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEIN
FLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRY
THRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDI
DQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQP
DGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKA
TKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGF
LNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML

3D structure

• PDB: 2p6f Crystal structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoyl-CoA and inhibitors reveal the functional roles of the N-terminal region.
• Chain: C
• Resolution: 3.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N169 F170 L171 T205 L455
• Catalytic site (residue number reindexed from 1): N150 F151 L152 T186 L436
• Enzyme Commision number: 2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MYA	C	H38 K39 F40 W41 V166 I168 N169 L171 V173 R178 S179 R181 T183 P184 I187 T191 V194 H201 Y204 T205 I208 L210 F425	H19 K20 F21 W22 V147 I149 N150 L152 V154 R159 S160 R162 T164 P165 I168 T172 V175 H182 Y185 T186 I189 L191 F406
BS02	GN8	C	F111 G207 Y219 F234	F92 G188 Y200 F215

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity
• GO:0016746 acyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2p6f, PDBe:2p6f, PDBj:2p6f
• PDBsum: 2p6f
• PubMed: 17513302
• UniProt: P14743|NMT_YEAST Glycylpeptide N-tetradecanoyltransferase (Gene Name=NMT1)