Structure of PDB 2p46 Chain C |
>2p46C (length=120) Species: 9913 (Bos taurus) [Search protein sequence] |
ETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTCKPVNTFVHESLADV QAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANK HIIVACEGNPYVPVHFDASV |
|
PDB | 2p46 Toward chaperone-assisted crystallography: protein engineering enhancement of crystal packing and X-ray phasing capabilities of a camelid single-domain antibody (VHH) scaffold |
Chain | C |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
H119 D121 |
H115 D117 |
|
|
|
|