Structure of PDB 2oiw Chain C |
>2oiwC (length=133) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] |
AMFTTVITPRVSETDGVGHINNTTVPVWFEAGRHEIFKLFTPDLSFKRWR MVIIRMEVDYVNQMYYGQDVTVYTGIERIGNTSLTIYEEIHQNGVVCAKG RSVYVNFNFDTGRPEPIPDDIRVKLREHVWQPG |
|
PDB | 2oiw The structure of a predicted thioesterase from Bacillus stearothermophilus |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
C |
S11 T13 |
S12 T14 |
|
|
|
|