Structure of PDB 2ode Chain C

Receptor sequence
>2odeC (length=317) Species: 9606 (Homo sapiens) [Search protein sequence]
AKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQS
IIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRL
WRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDY
DLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKR
SPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTK
NVQFVFDAVTDVIIKNN
3D structure
PDB2ode Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
ChainC
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E43 T48 R178 D200 Q204
Catalytic site (residue number reindexed from 1) E13 T18 R148 D170 Q174
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ALF C G42 E43 K46 R178 K180 T181 G203 Q204 G12 E13 K16 R148 K150 T151 G173 Q174
BS02 MG C S47 T181 S17 T151
BS03 GDP C E43 S44 G45 K46 S47 T48 L175 R176 T177 R178 N269 K270 D272 L273 C325 A326 T327 E13 S14 G15 K16 S17 T18 L145 R146 T147 R148 N239 K240 D242 L243 C295 A296 T297
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019001 guanyl nucleotide binding
GO:0019003 GDP binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0046872 metal ion binding
Biological Process
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007194 negative regulation of adenylate cyclase activity
GO:0007212 G protein-coupled dopamine receptor signaling pathway
GO:0016239 positive regulation of macroautophagy
GO:0046039 GTP metabolic process
GO:0051301 cell division
Cellular Component
GO:0000139 Golgi membrane
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005834 heterotrimeric G-protein complex
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030496 midbody
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ode, PDBe:2ode, PDBj:2ode
PDBsum2ode
PubMed18434541
UniProtP08754|GNAI3_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-3 (Gene Name=GNAI3)

[Back to BioLiP]