Structure of PDB 2nm2 Chain C

Receptor sequence

>2nm2C (length=121) Species: 1280 (Staphylococcus aureus)

MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLSEAGRTDNVID
TVHYGEVFEEVKSIMEGKAVNLLEHLAERIANRINSQYNRVMETKVRITK
ENPPIPGHYDGVGIEIVRENK

3D structure

• PDB: 2nm2 Structural basis for the aldolase and epimerase activities of Staphylococcus aureus dihydroneopterin aldolase.
• Chain: C
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E22 K100
• Catalytic site (residue number reindexed from 1): E22 K100
• Enzyme Commision number: 4.1.2.25: dihydroneopterin aldolase.
  5.1.99.8: 7,8-dihydroneopterin epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NEU	C	G17 A18 E22 L72 E74 K100	G17 A18 E22 L72 E74 K100

Gene Ontology

Molecular Function

• GO:0004150 dihydroneopterin aldolase activity
• GO:0016829 lyase activity
• GO:0016853 isomerase activity

Biological Process

• GO:0006760 folic acid-containing compound metabolic process
• GO:0046654 tetrahydrofolate biosynthetic process
• GO:0046656 folic acid biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2nm2, PDBe:2nm2, PDBj:2nm2
• PDBsum: 2nm2
• PubMed: 17331536
• UniProt: P56740|FOLB_STAAU Dihydroneopterin aldolase (Gene Name=folB)