Structure of PDB 2muw Chain C

Receptor sequence

>2muwC (length=31) Species: 499433 (Influenza A virus (A/Hong Kong/CUHK43751/2005(H3N2)))

SNDSSDPLVVAASIIGILHLILWILDRLFFK

3D structure

• PDB: 2muw Flipping in the Pore: Discovery of Dual Inhibitors That Bind in Different Orientations to the Wild-Type versus the Amantadine-Resistant S31N Mutant of the Influenza A Virus M2 Proton Channel.
• Chain: C
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	3LW	C	A30 G34	A12 G16

Gene Ontology

Molecular Function

• GO:0015078 proton transmembrane transporter activity

Biological Process

• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0033644 host cell membrane
• GO:0055036 virion membrane

External links

• PDB: RCSB:2muw, PDBe:2muw, PDBj:2muw
• PDBsum: 2muw
• PubMed: 25470189
• UniProt: B0LX40