Structure of PDB 2mff Chain C

Receptor sequence
>2mffC (length=59) Species: 294 (Pseudomonas fluorescens) [Search protein sequence]
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR
IQAGLTAPD
3D structure
PDB2mff Molecular basis for the wide range of affinity found in Csr/Rsm protein-RNA recognition.
ChainC
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna C L23 V25 S26 G27 Q28 Q29 R31 A36 P37 K38 V42 H43 R44 I47 L23 V25 S26 G27 Q28 Q29 R31 A36 P37 K38 V42 H43 R44 I47 PDBbind-CN: Kd=1.5uM
BS02 rna C M1 L2 I3 L4 T5 K7 M1 L2 I3 L4 T5 K7 PDBbind-CN: Kd=1.5uM
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0006109 regulation of carbohydrate metabolic process
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0045947 negative regulation of translational initiation
GO:0045948 positive regulation of translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2mff, PDBe:2mff, PDBj:2mff
PDBsum2mff
PubMed24561806
UniProtP0DPC3|CSRA1_PSEPH Translational regulator CsrA1 (Gene Name=csrA1)

[Back to BioLiP]