Structure of PDB 2krd Chain C |
>2krdC (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] |
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQ NPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS |
|
PDB | 2krd Solution structure of the regulatory domain of human cardiac troponin C in complex with the switch region of cardiac troponin I and W7: the basis of W7 as an inhibitor of cardiac muscle contraction. |
Chain | C |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
|