Structure of PDB 2jk5 Chain C

Receptor sequence

>2jk5C (length=103) Species: 1916 (Streptomyces lividans)

SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVE
TATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQER
RGH

3D structure

• PDB: 2jk5 Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
• Chain: C
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TBA	C	T74 T75	T53 T54

Gene Ontology

Molecular Function

• GO:0005249 voltage-gated potassium channel activity

Biological Process

• GO:0006813 potassium ion transport

Cellular Component

• GO:0008076 voltage-gated potassium channel complex

External links

• PDB: RCSB:2jk5, PDBe:2jk5, PDBj:2jk5
• PDBsum: 2jk5
• PubMed: 25093676
• UniProt: P0A334|KCSA_STRLI pH-gated potassium channel KcsA (Gene Name=kcsA)