Structure of PDB 2jet Chain C |
>2jetC (length=93) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
TPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVDSCMGDSGGPLV CQKDGVWTLAGIVSWGSGVCSTSTPGVYSRVTALMPWVQQILE |
|
PDB | 2jet The Crystal Structure of a Trypsin-Like Mutant Chymotrypsin: The Role of Position 226 in the Activity and Specificity of S189D Chymotrypsin. |
Chain | C |
Resolution | 2.2 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
C |
Q157 V206 W207 |
Q7 V56 W57 |
|
|
|
|