Structure of PDB 2j9e Chain C

Receptor sequence
>2j9eC (length=116) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence]
GSMKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRG
REYIVDLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVER
VVRVRTKEEGKEALLE
3D structure
PDB2j9e Structure of Glnk1 with Bound Effectors Indicates Regulatory Mechanism for Ammonia Uptake.
ChainC
Resolution1.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP C G27 M28 T29 V64 R101 R103 G29 M30 T31 V66 R103 R105
BS02 ATP C I7 G35 R36 G37 V38 P86 G87 G89 K90 F92 I9 G37 R38 G39 V40 P88 G89 G91 K92 F94
BS03 AKG C E50 Y51 I52 V53 D54 E52 Y53 I54 V55 D56
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0030234 enzyme regulator activity
Biological Process
GO:0006808 regulation of nitrogen utilization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2j9e, PDBe:2j9e, PDBj:2j9e
PDBsum2j9e
PubMed17203075
UniProtQ60381|GLNK1_METJA Nitrogen regulatory protein GlnK1 (Gene Name=glnK1)

[Back to BioLiP]