Structure of PDB 2iyn Chain C |
>2iynC (length=108) Species: 562 (Escherichia coli) [Search protein sequence] |
RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILL DWMLPGGSGIQFIKHLKRESMTRDIPVVMLTATGADDYITKPFSPKELVA RIKAVMRR |
|
PDB | 2iyn The Cofactor-Induced Pre-Active Conformation in Phob. |
Chain | C |
Resolution | 2.08 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
C |
D10 D53 M55 |
D8 D51 M53 |
|
|
|
|