Structure of PDB 2iqx Chain C

Receptor sequence

>2iqxC (length=186) Species: 10116 (Rattus norvegicus) [Search protein sequence]

MAADISQWAGPLSLQEVDEPPQHALRVDYGGVTVDELGKVLTPTQVMNRP
SSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSG
TVLSEYVGSGPPKDTGLHRYVWLVYEQEQPLNCDEPILSNKSGDNRGKFK
VEEFRKKYHLGAPVAGTCFQAEWDDSVPKLHDQLAG

3D structure

PDB

2iqx Rat Phosphatidylethanolamine-Binding Crystal structure of Protein Containing the S153E Mutation in the Complex with o-Phosphorylethanolamine

Chain

Resolution

2.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	OPE	C	D70 W84 H86 G110 P111 Y120	D70 W84 H86 G110 P111 Y120

Gene Ontology

	Molecular Function
GO:0004867	serine-type endopeptidase inhibitor activity
GO:0005102	signaling receptor binding
GO:0005524	ATP binding
GO:0008289	lipid binding
GO:0019899	enzyme binding
GO:0019900	kinase binding
GO:0019901	protein kinase binding
GO:0033612	receptor serine/threonine kinase binding
GO:0051019	mitogen-activated protein kinase binding

	Biological Process
GO:0000165	MAPK cascade
GO:0002026	regulation of the force of heart contraction
GO:0006979	response to oxidative stress
GO:0007286	spermatid development
GO:0009410	response to xenobiotic stimulus
GO:0009636	response to toxic substance
GO:0010466	negative regulation of peptidase activity
GO:0014823	response to activity
GO:0021766	hippocampus development
GO:0042755	eating behavior
GO:0043409	negative regulation of MAPK cascade
GO:0043950	positive regulation of cAMP-mediated signaling
GO:0045471	response to ethanol
GO:0045840	positive regulation of mitotic nuclear division
GO:0048240	sperm capacitation
GO:0051412	response to corticosterone
GO:0051591	response to cAMP
GO:0051592	response to calcium ion
GO:0051602	response to electrical stimulus
GO:0060409	positive regulation of acetylcholine metabolic process
GO:1905923	positive regulation of acetylcholine biosynthetic process

	Cellular Component
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0005741	mitochondrial outer membrane
GO:0008021	synaptic vesicle
GO:0009986	cell surface
GO:0016020	membrane
GO:0043025	neuronal cell body
GO:0043679	axon terminus
GO:0045177	apical part of cell

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2iqx, PDBe:2iqx, PDBj:2iqx
PDBsum	2iqx
PubMed
UniProt	P31044\|PEBP1_RAT Phosphatidylethanolamine-binding protein 1 (Gene Name=Pebp1)

[Back to BioLiP]