Structure of PDB 2ie4 Chain C

Receptor sequence
>2ie4C (length=288) Species: 9606 (Homo sapiens) [Search protein sequence]
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVC
GDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKV
RYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPL
TALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDD
RGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRN
VVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
3D structure
PDB2ie4 Structure of Protein Phosphatase 2A Core Enzyme Bound to Tumor-Inducing Toxins
ChainC
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H167
Catalytic site (residue number reindexed from 1) H162
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN C D85 N117 H167 H241 D80 N112 H162 H236
BS02 MN C D57 H59 D85 D52 H54 D80
BS03 OKA C R89 H118 Y127 H191 W200 R214 L243 Y265 R84 H113 Y122 H186 W195 R209 L238 Y260 PDBbind-CN: -logKd/Ki=10.00,IC50=0.1nM
BindingDB: IC50=7nM
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0004725 protein tyrosine phosphatase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0017018 myosin phosphatase activity
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0048156 tau protein binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0001932 regulation of protein phosphorylation
GO:0006470 protein dephosphorylation
GO:0007498 mesoderm development
GO:0010288 response to lead ion
GO:0010719 negative regulation of epithelial to mesenchymal transition
GO:0035331 negative regulation of hippo signaling
GO:0035556 intracellular signal transduction
GO:0035970 peptidyl-threonine dephosphorylation
GO:0040008 regulation of growth
GO:0043029 T cell homeostasis
GO:0045595 regulation of cell differentiation
GO:0051321 meiotic cell cycle
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070262 peptidyl-serine dephosphorylation
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:1900227 positive regulation of NLRP3 inflammasome complex assembly
GO:1904526 regulation of microtubule binding
GO:1904528 positive regulation of microtubule binding
GO:1904539 negative regulation of glycolytic process through fructose-6-phosphate
GO:2000045 regulation of G1/S transition of mitotic cell cycle
Cellular Component
GO:0000159 protein phosphatase type 2A complex
GO:0000775 chromosome, centromeric region
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0008287 protein serine/threonine phosphatase complex
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0045121 membrane raft
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0090443 FAR/SIN/STRIPAK complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ie4, PDBe:2ie4, PDBj:2ie4
PDBsum2ie4
PubMed17055435
UniProtP67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (Gene Name=PPP2CA)

[Back to BioLiP]