Structure of PDB 2iaa Chain C |
>2iaaC (length=128) Species: 511 (Alcaligenes faecalis) [Search protein sequence] |
ACDVSIEGNDSMQFNTKSIVVDKTCKEFTINLKHTGKLPKAAMGHNVVVS KKSDESAVATDGMKAGLNNDYVKAGDERVIAHTSVIGGGETDSVTFDVSK LKEGEDYAFFCSFPGHWSIMKGTIELGS |
|
PDB | 2iaa Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis. |
Chain | C |
Resolution | 1.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
H46 C112 H117 |
H45 C111 H116 |
|
|
|
|