Structure of PDB 2i89 Chain C

Receptor sequence
>2i89C (length=85) Species: 10116 (Rattus norvegicus) [Search protein sequence]
PAVTYYRLEEVAKHNTSESTWMVLHGRVYDLTRFLSEHPGGEEVLREQAG
ADATESFEDVGHSPDAREMSKQYYIGDVHPNDLKP
3D structure
PDB2i89 A histidine/tryptophan pi-stacking interaction stabilizes the heme-independent folding core of microsomal apocytochrome b5 relative to that of mitochondrial apocytochrome b5.
ChainC
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H39 G62
Catalytic site (residue number reindexed from 1) H38 G61
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM C M23 F35 H39 P40 G41 V45 L46 A54 F58 V61 H63 S64 A67 M70 S71 Y74 M22 F34 H38 P39 G40 V44 L45 A53 F57 V60 H62 S63 A66 M69 S70 Y73
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2i89, PDBe:2i89, PDBj:2i89
PDBsum2i89
PubMed17105194
UniProtP04166|CYB5B_RAT Cytochrome b5 type B (Gene Name=Cyb5b)

[Back to BioLiP]