Structure of PDB 2hap Chain C

Receptor sequence
>2hapC (length=76) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
RKRNRIPLRCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEA
EKELLKDNELKKLRERVKSLEKTLSK
3D structure
PDB2hap Structure of HAP1-18-DNA implicates direct allosteric effect of protein-DNA interactions on transcriptional activation.
ChainC
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K56 R70 K71 K2 R16 K17
BS02 dna C R55 R57 R59 R63 K71 R1 R3 R5 R9 K17
BS03 ZN C C64 C67 C74 C81 C10 C13 C20 C27
BS04 ZN C C64 C81 C84 C93 C10 C27 C30 C39
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2hap, PDBe:2hap, PDBj:2hap
PDBsum2hap
PubMed9886287
UniProtP0CS82|HAP1_YEASX Heme-responsive zinc finger transcription factor HAP1 (Gene Name=HAP1)

[Back to BioLiP]