Structure of PDB 2h8p Chain C

Receptor sequence

>2h8pC (length=57) Species: 32630 (synthetic construct)

SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACE
TATTVGY

3D structure

• PDB: 2h8p Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
• Chain: C
• Resolution: 2.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GOA	C	G77 Y78	G56 Y57

Gene Ontology

Molecular Function

• GO:0005249 voltage-gated potassium channel activity

Biological Process

• GO:0006813 potassium ion transport

Cellular Component

• GO:0008076 voltage-gated potassium channel complex

External links

• PDB: RCSB:2h8p, PDBe:2h8p, PDBj:2h8p
• PDBsum: 2h8p
• PubMed: 16939283
• UniProt: P0A334|KCSA_STRLI pH-gated potassium channel KcsA (Gene Name=kcsA)