Structure of PDB 2h65 Chain C |
>2h65C (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] |
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKY EVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGP VDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET |
|
PDB | 2h65 Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition |
Chain | C |
Resolution | 2.3 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
C |
R64 H121 C163 |
R31 H88 C130 |
|
|
|
|