Structure of PDB 2h5l Chain C

Receptor sequence

>2h5lC (length=430) Species: 10116 (Rattus norvegicus) [Search protein sequence]

DKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAG
CLHMTVETAVLIETLVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAW
KGETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTNLIHTKHPQLLSGIRG
ISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDG
IKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQA
AMEGYEVTTMDEACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHF
DVEIDVKWLNENAVEKVNIKPQVDRYLLKNGHRIILLAEGRLVNLGCAMG
HPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKL
NVKLTKLTEKQAQYLGMPINGPFKPDHYRY

3D structure

PDB

2h5l Structure and function of eritadenine and its 3-deaza analogues: Potent inhibitors of S-adenosylhomocysteine hydrolase and hypocholesterolemic agents.

Chain

Resolution

2.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H54 S77 S82 D130 E155 N180 K185 D189 N190 C194 H300 H352 S360 Q364
Catalytic site (residue number reindexed from 1)	H53 S76 S81 D129 E154 N179 K184 D188 N189 C193 H299 H351 S359 Q363
Enzyme Commision number	3.13.2.1: adenosylhomocysteinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	NAD	C	T157 T158 N190 G219 G221 D222 V223 T241 E242 I243 N247 T274 T275 I280 I298 G299 H300 L343 N345 H352	T156 T157 N189 G218 G220 D221 V222 T240 E241 I242 N246 T273 T274 I279 I297 G298 H299 L342 N344 H351
BS02	3DD	C	L53 T56 E58 D130 T156 K185 D189 L346 G351 H352	L52 T55 E57 D129 T155 K184 D188 L345 G350 H351
BS03	NAD	C	K425 Y429	K424 Y428

Gene Ontology

	Molecular Function
GO:0004013	adenosylhomocysteinase activity
GO:0005507	copper ion binding
GO:0016787	hydrolase activity
GO:0030554	adenyl nucleotide binding
GO:0042802	identical protein binding
GO:0051287	NAD binding
GO:0098604	adenosylselenohomocysteinase activity

	Biological Process
GO:0001666	response to hypoxia
GO:0002439	chronic inflammatory response to antigenic stimulus
GO:0006730	one-carbon metabolic process
GO:0007584	response to nutrient
GO:0019510	S-adenosylhomocysteine catabolic process
GO:0033353	S-adenosylmethionine cycle
GO:0042745	circadian sleep/wake cycle

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0042470	melanosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2h5l, PDBe:2h5l, PDBj:2h5l
PDBsum	2h5l
PubMed	17214973
UniProt	P10760\|SAHH_RAT Adenosylhomocysteinase (Gene Name=Ahcy)

[Back to BioLiP]