Structure of PDB 2gvf Chain C

Receptor sequence

>2gvfC (length=152)

QVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTN
VDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLL
SPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLET
TM

3D structure

• PDB: 2gvf P2-P4 macrocyclic inhibitors of hepatitis C virus NS3-4A serine protease.
• Chain: C
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H30 D54 G110 S112
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	G31 A111	G4 A84
BS02	peptide	C	Q28 V29 G31 E32 V33 I35 V36 S37 R62 T63 I64 A65 W85 P88 G90 A111	Q1 V2 G4 E5 V6 I8 V9 S10 R35 T36 I37 A38 W58 P61 G63 A84
BS03	ZN	C	C97 C99 C145	C70 C72 C118

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:2gvf, PDBe:2gvf, PDBj:2gvf
• PDBsum: 2gvf
• PubMed: 16730985
• UniProt: P26664|POLG_HCV1 Genome polyprotein