Structure of PDB 2grj Chain C

Receptor sequence

>2grjC (length=179) Species: 2336 (Thermotoga maritima)

HHHMVIGVTGKIGTGKSTVCEILKNKYGAHVVNVDRIGHEVLEEVKEKLV
ELFGGSVLEDGKVNRKKLAGIVFESRENLKKLELLVHPLMKKRVQEIINK
TSGLIVIEAALLKRMGLDQLCDHVITVVASRETILKRNREADRRLKFQED
IVPQGIVVANNSTLEDLEKKVEEVMKLVW

3D structure

• PDB: 2grj Crystal structure of Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) (tm1387) from THERMOTOGA MARITIMA at 2.60 A resolution
• Chain: C
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.24: dephospho-CoA kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	C	G10 G12 K13 S14 T15 R134 N157 S159	G13 G15 K16 S17 T18 R137 N160 S162
BS02	COD	C	V31 D32 H36 R62 H84 L108 R141 Q145	V34 D35 H39 R65 H87 L111 R144 Q148
BS03	ADP	C	E18 N22 L161 E165	E21 N25 L164 E168

Gene Ontology

Molecular Function

• GO:0004140 dephospho-CoA kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity

Biological Process

• GO:0015937 coenzyme A biosynthetic process
• GO:0016310 phosphorylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2grj, PDBe:2grj, PDBj:2grj
• PDBsum: 2grj
• UniProt: Q9X1A7|COAE_THEMA Dephospho-CoA kinase (Gene Name=coaE)