Structure of PDB 2gim Chain C |
>2gimC (length=106) [Search protein sequence] |
METYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNP AKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVG KITVAG |
|
PDB | 2gim Structure of plastocyanin from the cyanobacterium Anabaena variabilis. |
Chain | C |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
H39 C89 H92 M97 |
H40 C90 H93 M98 |
|
|
|
|