Structure of PDB 2gc4 Chain C |
>2gc4C (length=105) Species: 266 (Paracoccus denitrificans) [Search protein sequence] |
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREA MPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRG KVVVE |
|
PDB | 2gc4 Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin and cytochrome c551i. |
Chain | C |
Resolution | 1.9 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H53 C92 H95 |
Catalytic site (residue number reindexed from 1) |
H53 C92 H95 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
H53 C92 H95 M98 |
H53 C92 H95 M98 |
|
|
|
|