Structure of PDB 2fpd Chain C |
>2fpdC (length=62) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
GSEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARG VFPAYYAIEVTK |
|
PDB | 2fpd A unique set of SH3-SH3 interactions controls IB1 homodimerization |
Chain | C |
Resolution | 2.05 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GLC |
C |
S0 Y40 |
S2 Y42 |
|
|
|
|