Structure of PDB 2f9v Chain C

Receptor sequence

>2f9vC (length=152)

QVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTN
VDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLL
SPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLET
TM

3D structure

• PDB: 2f9v Depeptidization efforts on P3-P2 a-ketoamide inhibitors of HCV NS3-4A serine protease: Effect on HCV replicon activity.
• Chain: C
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H30 D54 G110 S112
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	G31 A111	G4 A84
BS02	peptide	C	V29 G31 E32 V33 I35 V36 S37 R62 T63 I64 A65 W85 P88 G90	V2 G4 E5 V6 I8 V9 S10 R35 T36 I37 A38 W58 P61 G63
BS03	ZN	C	C97 C99 C145	C70 C72 C118

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:2f9v, PDBe:2f9v, PDBj:2f9v
• PDBsum: 2f9v
• PubMed: 16387495
• UniProt: P27958|POLG_HCV77 Genome polyprotein