Structure of PDB 2f4y Chain C |
>2f4yC (length=108) Species: 1390 (Bacillus amyloliquefaciens) [Search protein sequence] |
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIG GDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDH YQTFTKIR |
|
PDB | 2f4y On the edge of the denaturation process: Application of X-ray diffraction to barnase and lysozyme cross-linked crystals with denaturants in molar concentrations. |
Chain | C |
Resolution | 2.15 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
E58 K60 |
E58 K60 |
|
|
|
|