Structure of PDB 2f44 Chain C |
>2f44C (length=62) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
LQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGVTR VGHRENIERALR |
|
PDB | 2f44 An architectural framework that may lie at the core of the postsynaptic density. |
Chain | C |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
E21 H22 H54 |
E20 H21 H53 |
|
|
|