Structure of PDB 2exv Chain C

Receptor sequence
>2exvC (length=81) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
DPEVLAKNKGCVACHAIDTKMVGPAYKDVAAKFAGQAGAEAELAQRIKNG
SQGVWGPIPMPPNAVSDDEAQTLAKWVLSQK
3D structure
PDB2exv Unveiling a Hidden Folding Intermediate in c-Type Cytochromes by Protein Engineering
ChainC
Resolution1.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC C C12 C15 H16 G24 P25 R47 I48 S52 Q53 G54 V55 W56 G57 I59 M61 N64 L74 C11 C14 H15 G23 P24 R46 I47 S51 Q52 G53 V54 W55 G56 I58 M60 N63 L73
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2exv, PDBe:2exv, PDBj:2exv
PDBsum2exv
PubMed16452476
UniProtP00099|CY551_PSEAE Cytochrome c-551 (Gene Name=nirM)

[Back to BioLiP]