Structure of PDB 2eqb Chain C |
>2eqbC (length=93) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
SNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNK EVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDT |
|
PDB | 2eqb Crystal structure of the Sec4p{middle dot}Sec2p complex in the nucleotide exchanging intermediate state |
Chain | C |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PO4 |
C |
R120 K123 |
R71 K74 |
|
|
|
|