Structure of PDB 2ejf Chain C |
>2ejfC (length=69) Species: 70601 (Pyrococcus horikoshii OT3) [Search protein sequence] |
NVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKR ILVKEGEAVDTGQPLIELG |
|
PDB | 2ejf Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BTN |
C |
M114 K115 |
M34 K35 |
|
|
|