Structure of PDB 2e76 Chain C

Receptor sequence

>2e76C (length=288) Species: 83541 (Mastigocladus laminosus) [Search protein sequence]

YPFWAQQTYPPTPREPTGRIVCANCHLAAKPAEVEVPQSVLPDTVFKAVV
KIPYDTKLQQVAADGSKVGLNVGAVLMLPEGFKIAPEERIPEELKKEVGD
VYFQPYKEGQDNVLLVGPLPGEQYQEIVFPVLSPNPTTDKNIHFGKYAIH
LGANRGRGQIYPTGEKSNNNVFTASATGTITKIAKEEDEYGNVKYQVSIQ
TDSGKTVVDTIPAGPELIVSEGQAVKAGEALTNNPNVGGFGQDDTEIVLQ
DPNRVKWMIAFICLVMLAQLMLILKKKQVEKVQAAEMN

3D structure

PDB

2e76 Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)

Chain

Resolution

3.41 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	Q38 S39 L41 T44 I259 I262 M266 Q269 L270 I273 K276 K277	Q38 S39 L41 T44 I259 I262 M266 Q269 L270 I273 K276 K277
BS02	HEM	C	Y1 P2 W4 C22 C25 H26 Q60 L70 N71 G73 A74 N154 G156 R157 G158 I160 Y161	Y1 P2 W4 C22 C25 H26 Q60 L70 N71 G73 A74 N154 G156 R157 G158 I160 Y161

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2e76, PDBe:2e76, PDBj:2e76
PDBsum	2e76
PubMed	17498743
UniProt	P83793\|CYF_MASLA Cytochrome f (Gene Name=petA)

[Back to BioLiP]