Structure of PDB 2d2n Chain C

Receptor sequence

>2d2nC (length=146) Species: 55676 (Oligobrachia mashikoi)

SCCSSEDRANVMHNWDAAWSAAYSDRRVALAQAVFASLFSRDAAAQGLFS
GVSADNPDSADFRAHCVRVVNGLDVAINMLNDPAVLNEQLAHLSAQHQAR
AGVAAAHFDVMAEAFAEVMPQVSSCFSSDSWNRCFARIANGISAGL

3D structure

• PDB: 2d2n Structure of an extracellular giant hemoglobin of the gutless beard worm Oligobrachia mashikoi.
• Chain: C
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	L49 F50 H66 R69 V70 L94 H98 R101 V104 H108 F109 M112 I143	L48 F49 H65 R68 V69 L93 H97 R100 V103 H107 F108 M111 I142
BS02	OXY	C	H66 V70	H65 V69

Gene Ontology

Molecular Function

• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001666 response to hypoxia
• GO:0015671 oxygen transport

Cellular Component

• GO:0005576 extracellular region
• GO:0005833 hemoglobin complex

External links

• PDB: RCSB:2d2n, PDBe:2d2n, PDBj:2d2n
• PDBsum: 2d2n
• PubMed: 16204001
• UniProt: Q7M418|GLBB2_OLIMA Extracellular giant hemoglobin major globin subunit B2 (Gene Name=ghbB2)