Structure of PDB 2c9o Chain C

Receptor sequence

>2c9oC (length=311) Species: 9606 (Homo sapiens) [Search protein sequence]

KSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELI
KSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEI
KKTEVLMENFRRAIGLRIKETKKKEIIQDVTLHDLDVAGEINKVVNKYID
QGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVI
RGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISE
EALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFY
DAKSSAKILAD

3D structure

PDB

2c9o Crystal structure of the human AAA+ protein RuvBL1.

Chain

Resolution

2.2 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	K76 T77 D302 T345 R404
Catalytic site (residue number reindexed from 1)	K70 T71 D164 T207 R266
Enzyme Commision number	3.6.4.12: DNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	C	S17 H18 H20 L39 V40 G73 T74 G75 K76 T77 Y366 I374 L403 R404	S11 H12 H14 L33 V34 G67 T68 G69 K70 T71 Y228 I236 L265 R266

Gene Ontology

	Molecular Function
GO:0001094	TFIID-class transcription factor complex binding
GO:0003678	DNA helicase activity
GO:0003713	transcription coactivator activity
GO:0004386	helicase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008094	ATP-dependent activity, acting on DNA
GO:0016787	hydrolase activity
GO:0016887	ATP hydrolysis activity
GO:0017025	TBP-class protein binding
GO:0043531	ADP binding
GO:0045296	cadherin binding
GO:0051117	ATPase binding

	Biological Process
GO:0000492	box C/D snoRNP assembly
GO:0000723	telomere maintenance
GO:0006275	regulation of DNA replication
GO:0006281	DNA repair
GO:0006282	regulation of DNA repair
GO:0006310	DNA recombination
GO:0006325	chromatin organization
GO:0006338	chromatin remodeling
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II
GO:0007283	spermatogenesis
GO:0032508	DNA duplex unwinding
GO:0033044	regulation of chromosome organization
GO:0042981	regulation of apoptotic process
GO:0045739	positive regulation of DNA repair
GO:0045893	positive regulation of DNA-templated transcription
GO:0045995	regulation of embryonic development
GO:0050821	protein stabilization
GO:0051276	chromosome organization
GO:0051301	cell division
GO:0051726	regulation of cell cycle
GO:0060382	regulation of DNA strand elongation
GO:0090263	positive regulation of canonical Wnt signaling pathway
GO:0090671	telomerase RNA localization to Cajal body
GO:1904507	positive regulation of telomere maintenance in response to DNA damage
GO:1905168	positive regulation of double-strand break repair via homologous recombination
GO:2000779	regulation of double-strand break repair

	Cellular Component
GO:0000786	nucleosome
GO:0000812	Swr1 complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0016020	membrane
GO:0016363	nuclear matrix
GO:0031011	Ino80 complex
GO:0035267	NuA4 histone acetyltransferase complex
GO:0070062	extracellular exosome
GO:0071339	MLL1 complex
GO:0097255	R2TP complex
GO:0101031	protein folding chaperone complex
GO:0120293	dynein axonemal particle
GO:1990062	RPAP3/R2TP/prefoldin-like complex
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2c9o, PDBe:2c9o, PDBj:2c9o
PDBsum	2c9o
PubMed	17060327
UniProt	Q9Y265\|RUVB1_HUMAN RuvB-like 1 (Gene Name=RUVBL1)

[Back to BioLiP]