Structure of PDB 2c21 Chain C |
>2c21C (length=139) Species: 5664 (Leishmania major) [Search protein sequence] |
SRRMLHTMIRVGDLDRSIKFYTERLGMKVLRKWDVPEDKYTLVFLGYGPE MSSTVLELTYNYGVTSYKHDEAYGHIAIGVEDVKELVADMRKHDVPIDYE DESGFMAFVVDPDGYYIELLNEKTMMEKAEADMKEQGTA |
|
PDB | 2c21 Specificity of the Trypanothione-Dependent Leishmania Major Glyoxalase I: Structure and Biochemical Comparison with the Human Enzyme. |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H8 E59 H77 E120 |
Catalytic site (residue number reindexed from 1) |
H6 E57 H75 E118 |
Enzyme Commision number |
4.4.1.5: lactoylglutathione lyase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NI |
C |
H8 E59 |
H6 E57 |
|
BS02 |
NI |
C |
H77 E120 |
H75 E118 |
|
|
|
|