Structure of PDB 2b3j Chain C

Receptor sequence
>2b3jC (length=152) Species: 158878 (Staphylococcus aureus subsp. aureus Mu50) [Search protein sequence]
MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQP
TAHAEHIAIERAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVY
GADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLLTTFFKNLRA
NK
3D structure
PDB2b3j Crystal structure of Staphylococcus aureus tRNA adenosine deaminase TadA in complex with RNA.
ChainC
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H53 C83 C86
Catalytic site (residue number reindexed from 1) H53 C83 C86
Enzyme Commision number 3.5.4.33: tRNA(adenine(34)) deaminase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C G22 I26 R44 H53 L80 D103 D104 S138 L141 F145 L148 R149 K152 G22 I26 R44 H53 L80 D103 D104 S138 L141 F145 L148 R149 K152
BS02 rna C R70 E72 R94 N123 R125 R70 E72 R94 N123 R125
BS03 ZN C H53 C83 C86 H53 C83 C86
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0008251 tRNA-specific adenosine deaminase activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0052717 tRNA-specific adenosine-34 deaminase activity
Biological Process
GO:0002100 tRNA wobble adenosine to inosine editing
GO:0008033 tRNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2b3j, PDBe:2b3j, PDBj:2b3j
PDBsum2b3j
PubMed16415880
UniProtQ99W51|TADA_STAAM tRNA-specific adenosine deaminase (Gene Name=tadA)

[Back to BioLiP]