Structure of PDB 2azu Chain C |
>2azuC (length=128) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSLPGNLPKNVMGHNWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLKEGEQYMFFCTFPGHSALMKGTLTLK |
|
PDB | 2azu X-ray crystal structure of the two site-specific mutants His35Gln and His35Leu of azurin from Pseudomonas aeruginosa. |
Chain | C |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
H46 C112 H117 |
H46 C112 H117 |
|
|
|
|