Structure of PDB 2a57 Chain C

Receptor sequence
>2a57C (length=146) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
LKGPELRILIVHARYNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGS
WELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLD
SGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
3D structure
PDB2a57 Structural basis of charge transfer complex formation by riboflavin bound to 6,7-dimethyl-8-ribityllumazine synthase
ChainC
Resolution2.75 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H94
Catalytic site (residue number reindexed from 1) H82
Enzyme Commision number 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CRM C Y27 G61 S62 W63 E64 V86 L87 Y15 G49 S50 W51 E52 V74 L75
BS02 CRM C I118 L119 I106 L107
Gene Ontology
Molecular Function
GO:0000906 6,7-dimethyl-8-ribityllumazine synthase activity
GO:0004746 riboflavin synthase activity
GO:0005515 protein binding
GO:0016740 transferase activity
GO:1902444 riboflavin binding
Biological Process
GO:0009231 riboflavin biosynthetic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005758 mitochondrial intermembrane space
GO:0009349 riboflavin synthase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2a57, PDBe:2a57, PDBj:2a57
PDBsum2a57
PubMed15265040
UniProtQ9UUB1|RIB4_SCHPO 6,7-dimethyl-8-ribityllumazine synthase (Gene Name=rib4)

[Back to BioLiP]