Structure of PDB 2a06 Chain C

Receptor sequence

>2a06C (length=365) Species: 9913 (Bos taurus) [Search protein sequence]

NNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFS
SVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWN
IGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWI
WGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSD
VDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNT
PPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRS
MMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILV
LMPTAGTIENKLLKW

3D structure

PDB

2a06 Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.

Chain

Resolution

2.1 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H201 S205 K227 D228 E271
Catalytic site (residue number reindexed from 1)	H187 S191 K213 D214 E257
Enzyme Commision number	1.10.2.2: Transferred entry: 7.1.1.8.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Q44 G48 L49 L51 R80 H83 G130 L133 P134 H182 F183 P186	Q30 G34 L35 L37 R66 H69 G116 L119 P120 H168 F169 P172
BS02	HEM	C	W31 G34 L37 H97 R100 S106 T112 W113 G116 L119 H196 L197 L200 S205 N206	W17 G20 L23 H83 R86 S92 T98 W99 G102 L105 H182 L183 L186 S191 N192
BS03	SMA	C	F128 M129 M138 G142 V145 I146 P270 E271 F274 Y278	F114 M115 M124 G128 V131 I132 P256 E257 F260 Y264	MOAD: Kd~30pM
BS04	UQ	C	L21 S35 L197 H201 S205 F220	L7 S21 L183 H187 S191 F206

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0048039	ubiquinone binding

	Biological Process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0031966	mitochondrial membrane
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2a06, PDBe:2a06, PDBj:2a06
PDBsum	2a06
PubMed	16024040
UniProt	P00157\|CYB_BOVIN Cytochrome b (Gene Name=MT-CYB)

[Back to BioLiP]