Structure of PDB 1zab Chain C

Receptor sequence

>1zabC (length=136) Species: 10090 (Mus musculus)

AVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENA
CYPLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQVMRE
FGTDWAVYMTKPDGTFVVRTVQELLPASFGPEDLQK

3D structure

• PDB: 1zab The 1.48 A Resolution Crystal Structure of the Homotetrameric Cytidine Deaminase from Mouse
• Chain: C
• Resolution: 2.36 Å

Enzymatic activity

• Enzyme Commision number: 3.5.4.5: cytidine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	URD	C	A58 C59 P61	A50 C51 P53
BS02	ZN	C	C65 C99 C102	C57 C91 C94
BS03	URD	C	V38 N54 E56 C65 S97	V30 N46 E48 C57 S89

Gene Ontology

Molecular Function

• GO:0001882 nucleoside binding
• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0019239 deaminase activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006248 CMP catabolic process
• GO:0006249 dCMP catabolic process
• GO:0009972 cytidine deamination
• GO:0030308 negative regulation of cell growth
• GO:0044206 UMP salvage
• GO:0045980 negative regulation of nucleotide metabolic process
• GO:0046898 response to cycloheximide
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0071217 cellular response to external biotic stimulus
• GO:0072527 pyrimidine-containing compound metabolic process
• GO:1901135 carbohydrate derivative metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1zab, PDBe:1zab, PDBj:1zab
• PDBsum: 1zab
• PubMed: 16784234
• UniProt: P56389|CDD_MOUSE Cytidine deaminase (Gene Name=Cda)