Structure of PDB 1z2c Chain C

Receptor sequence
>1z2cC (length=179) Species: 9606 (Homo sapiens) [Search protein sequence]
MAAIRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYIADIEVDG
KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT
PEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANR
ISAFGYLECSAKTKEGVREVFEMATRAGL
3D structure
PDB1z2c Structural and mechanistic insights into the interaction between Rho and mammalian Dia.
ChainC
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG C T19 T37 T19 T37
BS02 GNP C A15 C16 G17 K18 T19 C20 F30 Y34 P36 T37 G62 K118 D120 L121 S160 K162 A15 C16 G17 K18 T19 C20 F30 Y34 P36 T37 G62 K118 D120 L121 S160 K162
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019901 protein kinase binding
Biological Process
GO:0000281 mitotic cytokinesis
GO:0007015 actin filament organization
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0030335 positive regulation of cell migration
GO:0031334 positive regulation of protein-containing complex assembly
GO:0032956 regulation of actin cytoskeleton organization
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0043297 apical junction assembly
GO:0044319 wound healing, spreading of cells
GO:0051496 positive regulation of stress fiber assembly
GO:0060193 positive regulation of lipase activity
GO:1902766 skeletal muscle satellite cell migration
Cellular Component
GO:0005634 nucleus
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0032154 cleavage furrow
GO:0032420 stereocilium
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1z2c, PDBe:1z2c, PDBj:1z2c
PDBsum1z2c
PubMed15864301
UniProtP08134|RHOC_HUMAN Rho-related GTP-binding protein RhoC (Gene Name=RHOC)

[Back to BioLiP]