Structure of PDB 1ywh Chain C

Receptor sequence

>1ywhC (length=259) Species: 9606 (Homo sapiens) [Search protein sequence]

LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEK
TNRTLSYRTGLKITSLTEVVCGLDLCNQGNRYLECISCGSSDMSCERGRH
QSLQCRSPEEQCLDVVTHWIQPKDDRHLRGCGYLPGCPGSNGFHNNDTFH
FLKCCNTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCR
GPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCC
TKSGCNHPD

3D structure

PDB

1ywh Crystal structure of the human urokinase plasminogen activator receptor bound to an antagonist peptide

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	R2 R13 E16 D74 L75	R2 R13 E16 D74 L75
BS02	peptide	C	R53 T54 L55 Y57 L66 S100 S101 V125 T127 R142 H251 D254 A255	R53 T54 L55 Y57 L66 S90 S91 V115 T117 R126 H235 D238 A239

Gene Ontology

	Molecular Function
GO:0005102	signaling receptor binding
GO:0005515	protein binding
GO:0019899	enzyme binding
GO:0019904	protein domain specific binding
GO:0030377	urokinase plasminogen activator receptor activity
GO:0038023	signaling receptor activity

	Biological Process
GO:0001934	positive regulation of protein phosphorylation
GO:0006935	chemotaxis
GO:0007165	signal transduction
GO:0007596	blood coagulation
GO:0010755	regulation of plasminogen activation
GO:0030155	regulation of cell adhesion
GO:0030162	regulation of proteolysis
GO:0034112	positive regulation of homotypic cell-cell adhesion
GO:0038195	urokinase plasminogen activator signaling pathway
GO:0043066	negative regulation of apoptotic process
GO:0043388	positive regulation of DNA binding
GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway
GO:0051917	regulation of fibrinolysis
GO:0090200	positive regulation of release of cytochrome c from mitochondria
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway
GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway

	Cellular Component
GO:0005576	extracellular region
GO:0005788	endoplasmic reticulum lumen
GO:0005789	endoplasmic reticulum membrane
GO:0005886	plasma membrane
GO:0005925	focal adhesion
GO:0009897	external side of plasma membrane
GO:0009986	cell surface
GO:0016020	membrane
GO:0019898	extrinsic component of membrane
GO:0035579	specific granule membrane
GO:0042995	cell projection
GO:0070161	anchoring junction
GO:0098552	side of membrane
GO:0098637	protein complex involved in cell-matrix adhesion
GO:1905370	serine-type endopeptidase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ywh, PDBe:1ywh, PDBj:1ywh
PDBsum	1ywh
PubMed	15861141
UniProt	Q03405\|UPAR_HUMAN Urokinase plasminogen activator surface receptor (Gene Name=PLAUR)

[Back to BioLiP]